SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194353992|ref|NP_001123886.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194353992|ref|NP_001123886.1|
Domain Number 1 Region: 364-517
Classification Level Classification E-value
Superfamily PH domain-like 8.24e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000387
Further Details:      
 
Domain Number 2 Region: 531-654
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 646-728
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194353992|ref|NP_001123886.1|
Sequence length 737
Comment amyloid beta A4 precursor protein-binding family A member 2 isoform b [Homo sapiens]
Sequence
MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEE
YLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQ
EEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMT
SITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGF
KPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGP
CEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLF
ISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQE
GKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEM
YNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKL
SIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLG
FSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTM
PAAMFRLLTGQETPLYI
Download sequence
Identical sequences gi|194353992|ref|NP_001123886.1| ENSP00000409312 ENSP00000452722 ENSP00000483174 ENSP00000409312 ENSP00000452722 NP_001123886.1.87134 NP_001123886.1.92137 XP_016877602.1.92137 XP_016877603.1.92137 XP_016877604.1.92137 XP_016877605.1.92137 XP_016877606.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]