SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194394161|ref|NP_694992.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194394161|ref|NP_694992.2|
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily L domain-like 4.15e-40
Family Internalin LRR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194394161|ref|NP_694992.2|
Sequence length 239
Comment leucine-rich repeat-containing protein 57 [Homo sapiens]
Sequence
MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGK
FTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
GALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKI
LRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA
Download sequence
Identical sequences A0A024R9M3 G3R2C6 H2Q996 Q8N9N7
ENSP00000326817 ENSP00000380319 ENSP00000455445 ENSGGOP00000009373 9598.ENSPTRP00000011913 9606.ENSP00000326817 gi|194394161|ref|NP_694992.2| ENSPTRP00000011913 ENSPTRP00000011913 ENSP00000326817 ENSP00000380319 ENSP00000455445 ENSGGOP00000009373 NP_694992.2.87134 NP_694992.2.92137 XP_003314701.1.37143 XP_004056100.1.27298 XP_008971429.1.60992 XP_008971435.1.60992 ENSP00000326817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]