SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194440719|ref|NP_612490.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194440719|ref|NP_612490.1|
Domain Number 1 Region: 33-329
Classification Level Classification E-value
Superfamily L domain-like 6.01e-58
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 396-694
Classification Level Classification E-value
Superfamily L domain-like 4.85e-54
Family Ngr ectodomain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194440719|ref|NP_612490.1|
Sequence length 762
Comment chondroadherin-like protein precursor [Homo sapiens]
Sequence
MEGPRSSTHVPLVLPLLVLLLLAPARQAAAQRCPQACICDNSRRHVACRYQNLTEVPDAI
PELTQRLDLQGNLLKVIPAAAFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASN
HLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQG
LLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHN
PLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPG
QLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPRRLRGEALDALRPWDLRCPGD
AAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPESRHSSCEGCGLQAVP
RGFPSDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYL
SDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGD
LGRTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQL
SGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLHLQKNQLRALPA
LPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVGATCATPPNARGQRVKAAAAVFE
DCPGWAARKAKRTPASRPSARRTPIKGRQCGADKVGKEKGRL
Download sequence
Identical sequences Q6NUI6
ENSP00000392046 ENSP00000216241 9606.ENSP00000216241 gi|194440719|ref|NP_612490.1| NP_612490.1.87134 NP_612490.1.92137 ENSP00000216241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]