SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194440732|ref|NP_665878.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194440732|ref|NP_665878.2|
Domain Number 1 Region: 72-169
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.84e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.00000199
Further Details:      
 
Domain Number 2 Region: 6-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194440732|ref|NP_665878.2|
Sequence length 174
Comment maleylacetoacetate isomerase isoform 2 [Homo sapiens]
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMA
DLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Download sequence
Identical sequences A0A0A0MR33
NP_665878.2.87134 NP_665878.2.92137 ENSP00000314404 ENSP00000314404 gi|194440732|ref|NP_665878.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]