SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19526471|ref|NP_149035.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19526471|ref|NP_149035.1|
Domain Number 1 Region: 299-424
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000042
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|19526471|ref|NP_149035.1|
Domain Number - Region: 18-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.00123
Family HR1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19526471|ref|NP_149035.1|
Sequence length 550
Comment rhotekin isoform b [Homo sapiens]
Sequence
MQDRLHILEDLNMLYIRQMALSLEDTELQRKLDHEIRMREGACKLLAACSQREQALEATK
SLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWK
DTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRL
ELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSGSSPILLPTPVVGG
PRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTAS
GTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQ
ALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIET
PAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALP
NPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKG
QPRTWLQSPV
Download sequence
Identical sequences NP_149035.1.87134 NP_149035.1.92137 XP_016860124.1.92137 gi|19526471|ref|NP_149035.1| ENSP00000305298 ENSP00000305298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]