SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195927006|ref|NP_001124319.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195927006|ref|NP_001124319.1|
Domain Number 1 Region: 127-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.56e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|195927006|ref|NP_001124319.1|
Sequence length 324
Comment apoptosis-inducing factor 1, mitochondrial isoform 5 precursor [Homo sapiens]
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKDI
Download sequence
Identical sequences NP_001124319.1.87134 NP_001124319.1.92137 ENSP00000402535 ENSP00000446113 ENSP00000402535 gi|195927006|ref|NP_001124319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]