SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195927027|ref|NP_036248.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195927027|ref|NP_036248.3|
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 2.72e-47
Family SH2 domain 0.000014
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 6.54e-45
Family N-terminal domain of cbl (N-cbl) 0.00034
Further Details:      
 
Domain Number 3 Region: 326-404
Classification Level Classification E-value
Superfamily RING/U-box 2.5e-40
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 4 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 1.6e-38
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|195927027|ref|NP_036248.3|
Sequence length 474
Comment signal transduction protein CBL-C isoform 1 [Homo sapiens]
Sequence
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
Download sequence
Identical sequences Q9ULV8
ENSP00000270279 gi|195927027|ref|NP_036248.3| ENSP00000270279 NP_036248.3.87134 NP_036248.3.92137 ENSP00000270279 9606.ENSP00000270279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]