SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|195927030|ref|NP_001124324.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195927030|ref|NP_001124324.1|
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.36e-45
Family N-terminal domain of cbl (N-cbl) 0.00034
Further Details:      
 
Domain Number 2 Region: 280-358
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-39
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 3 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 1.09e-38
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|195927030|ref|NP_001124324.1|
Sequence length 428
Comment signal transduction protein CBL-C isoform 2 [Homo sapiens]
Sequence
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDS
TFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHG
QATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAAL
GPQDPAPA
Download sequence
Identical sequences ENSP00000340250 ENSP00000340250 gi|195927030|ref|NP_001124324.1| NP_001124324.1.87134 NP_001124324.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]