SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197382472|ref|NP_001128119.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197382472|ref|NP_001128119.1|
Domain Number 1 Region: 11-39,68-84,111-247
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-31
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 2 Region: 324-436
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-21
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Weak hits

Sequence:  gi|197382472|ref|NP_001128119.1|
Domain Number - Region: 636-725
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00111
Family Sec2 N-terminal region 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197382472|ref|NP_001128119.1|
Sequence length 814
Comment actin filament-associated protein 1 isoform a [Homo sapiens]
Sequence
MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLP
APPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSS
SYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCYKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQW
LKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGVVENGITTCNGKE
QVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGYLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAV
LEASSSEDMGRWIGILLAETGSSTDPEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISA
NPYLGGTSNGYAHPSGTALHYDDVPCINGSWEPEDGFPASCSRGLGEEVLYDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKP
PVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKRLQTKEEELLK
RKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERVSLELEL
TEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVN
SAAVLKKSQAAPGSSPCRGHVLRKAKEWELKNGT
Download sequence
Identical sequences ENSP00000371983 ENSP00000410689 ENSP00000353402 NP_001128119.1.87134 NP_001128119.1.92137 XP_011511846.1.92137 ENSP00000371983 ENSP00000410689 9606.ENSP00000410689 gi|197382472|ref|NP_001128119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]