SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19743848|ref|NP_598011.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19743848|ref|NP_598011.1|
Domain Number 1 Region: 53-237
Classification Level Classification E-value
Superfamily L domain-like 4.95e-30
Family Ngr ectodomain-like 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|19743848|ref|NP_598011.1|
Sequence length 250
Comment decorin isoform b precursor [Homo sapiens]
Sequence
MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLD
GNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLA
EHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYV
RSAIQLGNYK
Download sequence
Identical sequences A0A2I3T429
ENSP00000228329 ENSP00000413723 gi|19743848|ref|NP_598011.1| NP_598011.1.87134 NP_598011.1.92137 ENSP00000413723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]