SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19913443|ref|NP_602293.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19913443|ref|NP_602293.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 2.6e-57
Family Calmodulin-like 0.0000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|19913443|ref|NP_602293.1|
Sequence length 193
Comment hippocalcin-like protein 1 [Homo sapiens]
Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
Download sequence
Identical sequences P37235 Q6FGY1
NP_001245286.1.87134 NP_001245286.1.92137 NP_001245287.1.87134 NP_001245287.1.92137 NP_001245288.1.87134 NP_001245288.1.92137 NP_002140.2.87134 NP_002140.2.92137 NP_602293.1.87134 NP_602293.1.92137 XP_005246217.1.92137 XP_005246218.1.92137 XP_005246219.1.92137 XP_005246220.1.92137 XP_011508648.1.92137 XP_011508649.1.92137 XP_011508650.1.92137 XP_016859439.1.92137 XP_016859440.1.92137 XP_016859441.1.92137 XP_016859442.1.92137 ENSP00000310749 ENSP00000371184 ENSP00000478231 ENSP00000482993 ENSP00000483786 ENSP00000371184 ENSP00000310749 ENSP00000371184 gi|19913441|ref|NP_002140.2| gi|19913443|ref|NP_602293.1| 9606.ENSP00000310749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]