SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19913446|ref|NP_002134.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19913446|ref|NP_002134.2|
Domain Number 1 Region: 8-172
Classification Level Classification E-value
Superfamily EF-hand 2.63e-73
Family SCOPe 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|19913446|ref|NP_002134.2|
Sequence length 193
Comment neuron-specific calcium-binding protein hippocalcin [Homo sapiens]
Sequence
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
Download sequence
Identical sequences A0A0D9S7V9 A0A1S3FIX4 A0A1S3WBJ7 A0A1U7U8E0 A0A1U8CJ75 A0A286XRB8 A0A2I3LNA7 A0A2J8Y721 A0A2K5DG12 A0A2K5I2S5 A0A2K5NUR8 A0A2K5SCD7 A0A2K5WF58 A0A2K5Z6E7 A0A2K6D2C5 A0A2K6ESD5 A0A2K6KSL4 A0A2K6QSN2 A0A2K6TH77 D2HI47 F6ZL25 F7HSC9 G1QRX6 G3H932 G3R3H3 G3SUX4 G5B5K2 H0WH91 H2PYL2 I3MC08 L5JST7 L7N0Z1 L8HX05 M3YUT1 P84074 P84075 P84076 Q06AT1 Q4PL64 S7NFK1 S9YTL7
ENSTTRP00000013148 ENSSSCP00000003968 NP_001020499.1.59421 NP_001020499.1.76553 NP_001116597.1.46622 NP_001123891.1.92730 NP_001252671.1.72884 NP_001273010.1.92730 NP_001273012.1.92730 NP_002134.2.87134 NP_002134.2.92137 NP_034601.1.92730 NP_058818.1.100692 NP_058818.1.4139 XP_001155509.2.37143 XP_002720750.1.1745 XP_002750631.1.60252 XP_002921901.3.58354 XP_003276435.1.23891 XP_003276436.1.23891 XP_003471169.1.53824 XP_003500676.1.69978 XP_003801308.1.62490 XP_003812584.1.60992 XP_003812585.1.60992 XP_003937598.1.74449 XP_004025443.1.27298 XP_004266551.1.21590 XP_004372040.1.4749 XP_004425968.1.5094 XP_004591666.1.84141 XP_004603636.1.94378 XP_004641038.1.9945 XP_004665316.1.11716 XP_004678814.1.23501 XP_004705056.1.18182 XP_004740938.1.14098 XP_004850945.1.39548 XP_004850946.1.39548 XP_005079537.1.91757 XP_005202975.1.76553 XP_005202976.1.76553 XP_005202977.1.76553 XP_005270849.1.92137 XP_005317825.1.77405 XP_005353263.1.66349 XP_005395156.1.28644 XP_005395157.1.28644 XP_005544127.1.63531 XP_005544128.1.63531 XP_005617672.1.84170 XP_005665227.1.46622 XP_005878434.1.60319 XP_005878435.1.60319 XP_005906288.1.15283 XP_005978709.1.78601 XP_005978710.1.78601 XP_006054728.1.26621 XP_006094275.1.53796 XP_006176276.1.101512 XP_006197005.1.17985 XP_006238982.1.100692 XP_006238983.1.100692 XP_006502838.1.92730 XP_006502839.1.92730 XP_006502840.1.92730 XP_006734242.1.47382 XP_006777420.1.95426 XP_006777421.1.95426 XP_006862207.1.41390 XP_006886474.1.29581 XP_006924338.1.64745 XP_006934605.1.62641 XP_006995770.1.50099 XP_007182536.1.59432 XP_007182537.1.59432 XP_007468755.1.90284 XP_007523310.1.11023 XP_007637103.1.28591 XP_007948620.1.48129 XP_007977727.1.81039 XP_007977728.1.81039 XP_008062181.1.4292 XP_008271957.1.1745 XP_008580102.1.73410 XP_008827424.1.79516 XP_008827425.1.79516 XP_009451430.1.37143 XP_009451431.1.37143 XP_010352557.1.97406 XP_010620139.1.5607 XP_010835238.1.44457 XP_010950445.1.22495 XP_010950446.1.22495 XP_010974358.1.51371 XP_010974359.1.51371 XP_011238748.1.92730 XP_011356193.1.92234 XP_011761592.1.29376 XP_011761593.1.29376 XP_011761594.1.29376 XP_011810785.1.43180 XP_011829470.1.47321 XP_011935031.1.92194 XP_011935032.1.92194 XP_011996662.1.54773 XP_012296004.1.9421 XP_012296013.1.9421 XP_012497807.1.63892 XP_012620823.1.48125 XP_012620826.1.48125 XP_012875989.1.60039 XP_012975718.1.91757 XP_012975719.1.91757 XP_014199971.1.60992 XP_014315967.1.53796 XP_014315968.1.53796 XP_014315969.1.53796 XP_014337090.1.15283 XP_014337091.1.15283 XP_014337092.1.15283 XP_014405014.1.60319 XP_014407443.1.101512 XP_014925757.1.86478 XP_015096482.1.17985 XP_015096486.1.17985 XP_015428307.1.95426 XP_015844622.1.50099 XP_016005996.1.101085 XP_016043691.1.11023 XP_016043692.1.11023 XP_016073410.1.3490 XP_016856607.1.92137 XP_017205752.1.1745 XP_017383457.1.71028 XP_017523488.1.32401 XP_017523489.1.32401 XP_017740050.1.44346 XP_017740051.1.44346 XP_017740052.1.44346 XP_017913555.1.57651 XP_018870384.1.27298 XP_018870393.1.27298 XP_019285472.1.44245 XP_019514666.1.44202 XP_019514673.1.44202 XP_019514680.1.44202 XP_019514688.1.44202 XP_019585606.1.88060 XP_019585607.1.88060 XP_019585608.1.88060 XP_019585609.1.88060 XP_019658002.1.58354 XP_019834382.1.53367 XP_020029546.1.5219 XP_020751713.1.74333 XP_021056028.1.100879 XP_021492788.1.76796 XP_021539342.1.83697 XP_021590926.1.77405 XP_854592.3.84170 ENSLAFP00000003997 ENSBTAP00000010971 HGL_H00000362566 ENSOGAP00000000724 ENSOCUP00000011769 ENSMMUP00000022761 ENSPTRP00000000863 ENSMPUP00000015091 ENSMUSP00000030572 ENSGGOP00000009800 10090.ENSMUSP00000093486 10116.ENSRNOP00000009153 10141.ENSCPOP00000002268 9544.ENSMMUP00000022761 9598.ENSPTRP00000000863 9606.ENSP00000362566 9913.ENSBTAP00000010971 9986.ENSOCUP00000011769 5g4p_A 5g4p_E ENSMPUP00000015091 ENSETEP00000008895 ENSMUSP00000030572 ENSMUSP00000093486 ENSMUSP00000112143 ENSMUSP00000112145 ENSMUSP00000119178 ENSMUSP00000129548 ENSSARP00000011066 ENSMLUP00000000700 ENSDORP00000009664 ENSP00000362566 ENSSSCP00000003968 ENSP00000362566 ENSCPOP00000002268 ENSNLEP00000003694 ENSPCAP00000010579 ENSRNOP00000009153 ENSMLUP00000000700 ENSCPOP00000002268 ENSPVAP00000000335 ENSCJAP00000001846 ENSTTRP00000013148 ENSAMEP00000007854 ENSAMEP00000007854 ENSFCAP00000003303 ENSOGAP00000000724 ENSSTOP00000007750 ENSPVAP00000000335 ENSOPRP00000002293 ENSPANP00000015843 ENSPTRP00000000863 ENSCJAP00000001846 ENSCJAP00000051111 ENSMICP00000010222 ENSSARP00000011066 ENSMUSP00000030572 ENSGGOP00000009800 ENSSTOP00000007750 ENSRNOP00000009153 ENSDORP00000009664 ENSETEP00000008895 ENSOPRP00000002293 ENSBTAP00000010971 ENSP00000362566 ENSMMUP00000022761 ENSPCAP00000010579 ENSMICP00000010222 ENSNLEP00000003694 gi|19913446|ref|NP_002134.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]