SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19923493|ref|NP_061885.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923493|ref|NP_061885.2|
Domain Number 1 Region: 119-265
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-39
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 53-88
Classification Level Classification E-value
Superfamily WW domain 0.00000000608
Family WW domain 0.0023
Further Details:      
 
Domain Number 3 Region: 9-45
Classification Level Classification E-value
Superfamily WW domain 0.0000000252
Family WW domain 0.004
Further Details:      
 
Weak hits

Sequence:  gi|19923493|ref|NP_061885.2|
Domain Number - Region: 713-738
Classification Level Classification E-value
Superfamily Bacillus phage protein 0.0942
Family Bacillus phage protein 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19923493|ref|NP_061885.2|
Sequence length 1116
Comment pleckstrin homology domain-containing family A member 5 isoform 1 [Homo sapiens]
Sequence
MAADLNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPT
GWEEAYTFEGARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPIS
MINEASNYNVTSDYAVHPMSPVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQD
STGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAH
PNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKITSENAPTKETNNIPNHRVLI
KPEIQNNQKNKEMSKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLPSEYESGSACP
AQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKI
QKGRGHEEETRGVISYQTLPRNMPSHRAQIMARYPEGYRTLPRNSKTRPESICSVTPSTH
DKTLGPGAEEKRRSMRDDTMWQLYEWQQRQFYNKQSTLPRHSTLSSPKTMVNISDQTMHS
IPTSPSHGSIAAYQGYSPQRTYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAG
LTLQSVSPQSLQGKTLSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVHALEEKLQQLH
KEKYTLEQALLSASQEIEMHADNPAAIQTVVLQRDDLQNGLLSTCRELSRATAELERAWR
EYDKLEYDVTVTRNQMQEQLDHLGEVQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRG
TTEIGMIGSKPFSTVKYKNEGPDYRLYKSEPELTTVAEVDESNGEEKSEPVSEIETSVVK
GSHFPVGVVPPRAKSPTPESSTIASYVTLRKTKKMMDLRTERPRSAVEQLCLAESTRPRM
TVEEQMERIRRHQQACLREKKKGLNVIGASDQSPLQSPSNLRDNPFRTTQTRRRDDKELD
TAIRENDVKPDHETPATEIVQLKETEPQNVDFSKELKKTENISYEMLFEPEPNGVNSVEM
MDKERNKDKMPEDVTFSPQDETQTANHKPEEHPEENTKNSVDEQEETVISYESTPEVSRG
NQTMAVKSLSPSPESSASPVPSTQPQLTEGSHFMCV
Download sequence
Identical sequences Q9HAU0
NP_061885.2.87134 NP_061885.2.92137 9606.ENSP00000299275 ENSP00000299275 ENSP00000299275 gi|19923493|ref|NP_061885.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]