SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19923540|ref|NP_060177.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923540|ref|NP_060177.2|
Domain Number 1 Region: 544-694
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.26e-62
Family Ankyrin repeat 0.0000151
Further Details:      
 
Domain Number 2 Region: 32-265,300-325
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.27e-53
Family BAR domain 0.027
Further Details:      
 
Domain Number 3 Region: 428-543
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000119
Further Details:      
 
Domain Number 4 Region: 279-397
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19923540|ref|NP_060177.2|
Sequence length 903
Comment arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 isoform a [Homo sapiens]
Sequence
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD
Download sequence
Identical sequences A0A024RAB1 Q8TDY4
ENSP00000338769 ENSP00000338769 NP_060177.2.87134 NP_060177.2.92137 9606.ENSP00000338769 ENSP00000338769 gi|19923540|ref|NP_060177.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]