SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19923592|ref|NP_073613.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923592|ref|NP_073613.2|
Domain Number 1 Region: 364-466,497-742
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.32e-112
Family Oxysterol-binding protein 0.00004
Further Details:      
 
Domain Number 2 Region: 61-173
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|19923592|ref|NP_073613.2|
Sequence length 747
Comment oxysterol-binding protein-related protein 11 [Homo sapiens]
Sequence
MQGGEPVSTMKVSESEGKLEGQATAVTPNKNSSCGGGISSSSSSRGGSAKGWQYSDHMEN
VYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDS
HTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSRSFSLASSSN
SPISQRRPSQNAISFFNVGHSKLQSLSKRTNLPPDHLVEVREMMSHAEGQQRDLIRRIEC
LPTSGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQKGSLPSGTTIEWLEPKI
SLSNHYKNGADQPFATDQSKPVAVPEEQPVAESGLLAREPEEINADDEIEDTCDHKEDDL
GAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFIAITNGAT
AEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQG
VTNHAPLSGESLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFL
GMSIGVTMVGEGILSLLEHGEEYTFSLPCAYARSILTVPWVELGGKVSVNCAKTGYSASI
TFHTKPFYGGKLHRVTAEVKHNITNTVVCRVQGEWNSVLEFTYSNGETKYVDLTKLAVTK
KRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTLEERQRTEERHRTETGTPWKT
KYFIKEGDGWVYHKPLWKIIPTTQPAE
Download sequence
Identical sequences A0A140VJQ6 Q9BXB4
ENSP00000296220 gi|19923592|ref|NP_073613.2| NP_073613.2.87134 NP_073613.2.92137 ENSP00000296220 9606.ENSP00000296220 ENSP00000296220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]