SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19923987|ref|NP_612463.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19923987|ref|NP_612463.1|
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000113
Family Glutathione peroxidase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19923987|ref|NP_612463.1|
Sequence length 212
Comment nucleoredoxin-like protein 1 [Homo sapiens]
Sequence
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVR
LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERL
PAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTEC
LRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Download sequence
Identical sequences H2R1V8 Q96CM4
gi|19923987|ref|NP_612463.1| ENSP00000305631 ENSP00000305631 9606.ENSP00000305631 ENSP00000305631 NP_612463.1.87134 NP_612463.1.92137 XP_016790935.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]