SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20070228|ref|NP_006175.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20070228|ref|NP_006175.2|
Domain Number 1 Region: 229-321
Classification Level Classification E-value
Superfamily EF-hand 8.13e-18
Family EF-hand modules in multidomain proteins 0.00000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20070228|ref|NP_006175.2|
Sequence length 461
Comment nucleobindin-1 precursor [Homo sapiens]
Sequence
MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Download sequence
Identical sequences Q02818
ENSP00000263273 ENSP00000263273 ENSP00000385211 ENSP00000385923 NP_006175.2.87134 NP_006175.2.92137 XP_016882334.1.92137 9606.ENSP00000263273 gi|20070228|ref|NP_006175.2| ENSP00000385211 ENSP00000385923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]