SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20070302|ref|NP_060580.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20070302|ref|NP_060580.2|
Domain Number 1 Region: 131-241
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000577
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily PH domain-like 6.31e-17
Family Pleckstrin-homology domain (PH domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20070302|ref|NP_060580.2|
Sequence length 326
Comment docking protein 4 [Homo sapiens]
Sequence
MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET
DLLNRFILLKPKPSQGDSSEAKTPSQ
Download sequence
Identical sequences A0A024R6S2 A0A096NIT3 A0A0D9QXX3 A0A2K5DCK1 A0A2K5HWA8 A0A2K5MS48 A0A2K5YAC4 A0A2K6LVK5 A0A2K6PW78 F6VK00 G3R9P0 G7Q182 H0XGA8 H2NR08 H2QB72 Q8TEW6 U3DIP2
gi|20070302|ref|NP_060580.2| ENSOGAP00000015104 NP_001253084.1.72884 NP_060580.2.87134 NP_060580.2.92137 XP_002761055.1.60252 XP_003792620.1.62490 XP_003823788.1.60992 XP_005256100.1.92137 XP_005592096.1.63531 XP_007991629.1.81039 XP_007991631.1.81039 XP_007991632.1.81039 XP_009249025.1.23681 XP_009249026.1.23681 XP_009249027.1.23681 XP_009429144.1.37143 XP_009429145.1.37143 XP_009429146.1.37143 XP_009429147.1.37143 XP_010363786.1.97406 XP_010363787.1.97406 XP_010363788.1.97406 XP_010363789.1.97406 XP_011794222.1.43180 XP_011794224.1.43180 XP_011827234.1.47321 XP_011827235.1.47321 XP_011920430.1.92194 XP_011920435.1.92194 XP_011920442.1.92194 XP_011920452.1.92194 XP_011920459.1.92194 XP_012303304.1.9421 XP_012606873.1.48125 XP_012606874.1.48125 XP_012606875.1.48125 XP_014981662.1.72884 XP_014981663.1.72884 XP_014981664.1.72884 XP_015298503.1.63531 XP_015298504.1.63531 XP_017358126.1.71028 XP_017734335.1.44346 XP_017734336.1.44346 XP_017734337.1.44346 XP_017734338.1.44346 XP_017734339.1.44346 XP_017734340.1.44346 XP_018867573.1.27298 ENSPANP00000012881 ENSMMUP00000026971 ENSPPYP00000008351 ENSP00000344277 ENSP00000455128 ENSP00000344277 ENSP00000455128 ENSPTRP00000013928 ENSPTRP00000013928 ENSPPYP00000008351 ENSOGAP00000015104 ENSMMUP00000026971 9544.ENSMMUP00000026971 9598.ENSPTRP00000013928 9606.ENSP00000344277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]