SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20070380|ref|NP_612640.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20070380|ref|NP_612640.1|
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000123
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20070380|ref|NP_612640.1|
Sequence length 115
Comment pro-neuregulin-4, membrane-bound isoform [Homo sapiens]
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Download sequence
Identical sequences Q8WWG1
ENSP00000303071 ENSP00000378367 ENSP00000457335 NP_612640.1.87134 NP_612640.1.92137 XP_016877434.1.92137 XP_016877435.1.92137 XP_016877436.1.92137 XP_016877437.1.92137 ENSP00000378367 ENSP00000457335 9606.ENSP00000378367 gi|20070380|ref|NP_612640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]