SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20143971|ref|NP_006059.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20143971|ref|NP_006059.2|
Domain Number 1 Region: 635-783
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-46
Family Toll/Interleukin receptor TIR domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 331-583
Classification Level Classification E-value
Superfamily L domain-like 7.78e-33
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 3 Region: 35-205,346-390
Classification Level Classification E-value
Superfamily L domain-like 9.07e-19
Family Ngr ectodomain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20143971|ref|NP_006059.2|
Sequence length 796
Comment toll-like receptor 6 precursor [Homo sapiens]
Sequence
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS
Download sequence
Identical sequences Q9Y2C9
gi|20143971|ref|NP_006059.2| NP_006059.2.87134 NP_006059.2.92137 XP_005262694.1.92137 XP_011511914.1.92137 XP_011511915.1.92137 XP_011511916.1.92137 ENSP00000371376 ENSP00000389600 9606.ENSP00000371376 ENSP00000371376 ENSP00000371376 ENSP00000389600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]