SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20149496|ref|NP_079478.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20149496|ref|NP_079478.1|
Domain Number 1 Region: 80-156
Classification Level Classification E-value
Superfamily EF-hand 3.59e-18
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20149496|ref|NP_079478.1|
Sequence length 239
Comment EF-hand domain-containing protein D1 isoform 1 [Homo sapiens]
Sequence
MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLS
RRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMME
KLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDV
ALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
Download sequence
Identical sequences H2QJM2 Q9BUP0
9598.ENSPTRP00000022301 9606.ENSP00000264059 gi|20149496|ref|NP_079478.1| ENSP00000386243 ENSPTRP00000022301 NP_079478.1.87134 NP_079478.1.92137 ENSP00000264059 ENSP00000264059 ENSPTRP00000022301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]