SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20149675|ref|NP_077305.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20149675|ref|NP_077305.2|
Domain Number 1 Region: 73-167
Classification Level Classification E-value
Superfamily EF-hand 9.92e-19
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20149675|ref|NP_077305.2|
Sequence length 240
Comment EF-hand domain-containing protein D2 [Homo sapiens]
Sequence
MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLL
RRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLM
MEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEI
DVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK
Download sequence
Identical sequences A0A024QZ77 A0A0D9S8I7 A0A2I3NCT0 A0A2K5KNY4 A0A2K6BFH9 K7BEJ8 Q96C19
ENSP00000365147 ENSP00000365147 ENSP00000365147 gi|20149675|ref|NP_077305.2| NP_077305.2.87134 NP_077305.2.92137 XP_007978635.1.81039 XP_011725178.1.29376 XP_011932466.1.92194 XP_016810076.1.37143 9606.ENSP00000365147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]