SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|201861823|ref|NP_001128472.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|201861823|ref|NP_001128472.1|
Domain Number 1 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 576-629
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000406
Family Third domain of FERM 0.0085
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000072
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 519-575
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000602
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|201861823|ref|NP_001128472.1|
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00776
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|201861823|ref|NP_001128472.1|
Sequence length 633
Comment fermitin family homolog 2 isoform 3 [Homo sapiens]
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQPGYIRD
LITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRL
IRMDASTGDAIKTWRFSNMKQWNVNWEIKMVNS
Download sequence
Identical sequences A0A2J8PHC8
gi|201861823|ref|NP_001128472.1| NP_001128472.1.87134 NP_001128472.1.92137 ENSP00000382243 ENSP00000382243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]