SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20270303|ref|NP_620124.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20270303|ref|NP_620124.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-30
Family G proteins 0.00089
Further Details:      
 
Domain Number 2 Region: 413-580
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-20
Family G proteins 0.022
Further Details:      
 
Domain Number 3 Region: 168-268,310-365
Classification Level Classification E-value
Superfamily EF-hand 3.74e-17
Family Calmodulin-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|20270303|ref|NP_620124.1|
Sequence length 618
Comment mitochondrial Rho GTPase 2 [Homo sapiens]
Sequence
MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILVGNKS
DLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQ
LRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGG
VREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTE
LNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHG
YLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCK
VVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLAT
SLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPA
EFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGA
AVAAVLSFSLYRVLVKSQ
Download sequence
Identical sequences Q8IXI1
gi|20270303|ref|NP_620124.1| ENSP00000321971 NP_620124.1.87134 NP_620124.1.92137 ENSP00000321971 9606.ENSP00000321971 ENSP00000321971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]