SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20336726|ref|NP_073603.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20336726|ref|NP_073603.2|
Domain Number 1 Region: 129-331,380-462,499-524
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.63e-58
Family Diacylglycerol kinase-like 0.006
Further Details:      
 
Weak hits

Sequence:  gi|20336726|ref|NP_073603.2|
Domain Number - Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0169
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20336726|ref|NP_073603.2|
Sequence length 537
Comment ceramide kinase [Homo sapiens]
Sequence
MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAV
EETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLR
EMLEKLTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETL
YEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGS
TDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDS
EKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQ
LEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDL
ILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRF
GHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
Download sequence
Identical sequences A0A024R4U8 Q8TCT0
ENSP00000216264 gi|20336726|ref|NP_073603.2| ENSP00000216264 HR6823 NYSGRC-20336726 9606.ENSP00000216264 NP_073603.2.87134 NP_073603.2.92137 ENSP00000216264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]