SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|205360930|ref|NP_065998.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|205360930|ref|NP_065998.3|
Domain Number - Region: 15-133
Classification Level Classification E-value
Superfamily EF-hand 0.0143
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|205360930|ref|NP_065998.3|
Sequence length 456
Comment hypothetical protein LOC57707 [Homo sapiens]
Sequence
MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPP
EMVTRLYDGMRRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGP
VKAREVQKFTEDLVGSVVHVLSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKR
LLGPQWLDYDCDRAVIEDWVFRVPHVAIFLSVVICKGFLILCSSLDLTTLVPERQVDQGR
GFESILDVLSVMYINAQLPREQRHRWCLLFSSELHGHSFSQLCGHITHRGPCVAVLEDHD
KHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNHGQQTIPNGLG
MGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA
KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE
Download sequence
Identical sequences Q6P9B6
9606.ENSP00000343635 ENSP00000343635 ENSP00000343635 gi|205360930|ref|NP_065998.3| ENSP00000343635 NP_065998.3.87134 NP_065998.3.92137 XP_005256132.1.92137 XP_006721303.1.92137 XP_011521550.1.92137 XP_011521551.1.92137 XP_016878999.1.92137 XP_016879000.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]