SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|205360958|ref|NP_077300.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|205360958|ref|NP_077300.3|
Domain Number 1 Region: 180-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000106
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|205360958|ref|NP_077300.3|
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|205360958|ref|NP_077300.3|
Sequence length 353
Comment cysteine-rich with EGF-like domain protein 2 isoform b [Homo sapiens]
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPP
CSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECSLAEKT
CVRKNENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDL
Download sequence
Identical sequences Q6UXH1
ENSP00000332223 ENSP00000332223 NP_077300.3.87134 NP_077300.3.92137 gi|205360958|ref|NP_077300.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]