SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206597513|ref|NP_056057.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206597513|ref|NP_056057.2|
Domain Number 1 Region: 721-898
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 290-406
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 35-174
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-27
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 
Domain Number 4 Region: 432-603
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-26
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 1032-1187
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000104
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 6 Region: 197-291
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000478
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 618-746
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000233
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|206597513|ref|NP_056057.2|
Domain Number - Region: 933-1017
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000827
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206597513|ref|NP_056057.2|
Sequence length 1205
Comment arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 isoform a [Homo sapiens]
Sequence
MTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSSLSLSL
PSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKD
AYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAEQRARA
RLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGITFIDM
SVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAERIWAAA
PNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETLIELF
LQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKA
LCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNRTTEVP
RLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGVLSYFE
NERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHEWVKCI
AKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQ
LRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTLSEQQL
GDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVD
DVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKAL
ISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFSVDEEE
LRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAEELTLE
ILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQAMEAM
LLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQRPWSG
APETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELR
EWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLS
LLRNV
Download sequence
Identical sequences NP_056057.2.87134 NP_056057.2.92137 gi|206597513|ref|NP_056057.2| ENSP00000335506 ENSP00000335506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]