SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206725447|ref|NP_001128689.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206725447|ref|NP_001128689.1|
Domain Number 1 Region: 73-311
Classification Level Classification E-value
Superfamily L domain-like 3.57e-33
Family Internalin LRR domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206725447|ref|NP_001128689.1|
Sequence length 343
Comment leucine-rich repeat-containing protein 23 isoform a [Homo sapiens]
Sequence
MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLL
CKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKA
DGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLIS
LHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGF
SREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTDETSYRQEALVQMPYLE
RLDKEFYEEEERAEADVIRQRLKEEKEQEPEPQRDLEPEQSLI
Download sequence
Identical sequences Q53EV4
ENSP00000390932 NP_001128689.1.87134 NP_001128689.1.92137 NP_964013.1.87134 NP_964013.1.92137 9606.ENSP00000007969 ENSP00000007969 ENSP00000390932 ENSP00000469415 ENSP00000471955 ENSP00000007969 ENSP00000390932 gi|206725447|ref|NP_001128689.1| gi|42542396|ref|NP_964013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]