SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206725547|ref|NP_001128684.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206725547|ref|NP_001128684.1|
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily FKBP-like 1.12e-34
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 150-216
Classification Level Classification E-value
Superfamily EF-hand 0.000000000187
Family Calbindin D9K 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206725547|ref|NP_001128684.1|
Sequence length 221
Comment peptidyl-prolyl cis-trans isomerase FKBP7 isoform b precursor [Homo sapiens]
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKD
EKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Download sequence
Identical sequences ENSP00000415486 ENSP00000415486 gi|206725547|ref|NP_001128684.1| NP_001128684.1.87134 NP_001128684.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]