SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209862793|ref|NP_001129476.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209862793|ref|NP_001129476.1|
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-37
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.12e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 880-913
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000079
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|209862793|ref|NP_001129476.1|
Domain Number - Region: 914-942
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000306
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209862793|ref|NP_001129476.1|
Sequence length 1073
Comment protein MICAL-3 isoform 2 [Homo sapiens]
Sequence
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMESLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGHRGERPTLVSTLTDRRMDVAVGNQN
KVKYMATQLLAKFEENAPAQSIGIRRQQREKECSRTCPKKVITLSPPPTPPPCRAHGGQQ
TYRDLDADNRGKQSPHHERPEPEPPRRFFVDQWELSLSLRSSARPASPSSDSLRQKYIKM
YTGGVSSLAEQIANQLQRKEQPKALLDKKELGSMKKEFPQNLGGSDTCYFCQKRVYVMER
LSAEGKFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPL
SGKEAKGPLQDGATTDANGRANAVASSTERTPGSLTSLFGWVARHSLGLCDKAKGMSQHL
QSNISSFGQQVAQNPLDSFFMCQLLAFGVPFLYGLSEVLVQIRGEFHWQAVAQ
Download sequence
Identical sequences gi|209862793|ref|NP_001129476.1| ENSP00000462033 NP_001129476.1.87134 NP_001129476.1.92137 ENSP00000414846 ENSP00000462033 9606.ENSP00000414846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]