SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|210147571|ref|NP_001129951.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|210147571|ref|NP_001129951.1|
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily L domain-like 2.21e-22
Family U2A'-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|210147571|ref|NP_001129951.1|
Sequence length 220
Comment acidic leucine-rich nuclear phosphoprotein 32 family member E isoform 3 [Homo sapiens]
Sequence
MANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEA
LQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDE
DDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQD
EEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD
Download sequence
Identical sequences A0A2J8JJ13
ENSP00000358115 gi|210147571|ref|NP_001129951.1| ENSP00000481415 NP_001129951.1.87134 NP_001129951.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]