SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21070997|ref|NP_003147.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21070997|ref|NP_003147.2|
Domain Number 1 Region: 121-203
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000148
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Weak hits

Sequence:  gi|21070997|ref|NP_003147.2|
Domain Number - Region: 63-127
Classification Level Classification E-value
Superfamily EF-hand 0.0164
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21070997|ref|NP_003147.2|
Sequence length 685
Comment stromal interaction molecule 1 precursor [Homo sapiens]
Sequence
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
Download sequence
Identical sequences K7CNV5 Q13586
9598.ENSPTRP00000005665 9606.ENSP00000300737 ENSP00000300737 ENSNLEP00000021023 ENSNLEP00000021023 ENSP00000300737 gi|21070997|ref|NP_003147.2| NP_003147.2.87134 NP_003147.2.92137 XP_001160553.1.37143 XP_003254842.1.23891 ENSPTRP00000005665 ENSPTRP00000005665 ENSP00000300737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]