SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21071018|ref|NP_620641.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21071018|ref|NP_620641.1|
Domain Number 1 Region: 26-149
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-40
Family Phosphotyrosine-binding domain (PTB) 0.00048
Further Details:      
 
Domain Number 2 Region: 444-524
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-19
Family SH3-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  gi|21071018|ref|NP_620641.1|
Domain Number - Region: 532-588
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00743
Family SAM (sterile alpha motif) domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21071018|ref|NP_620641.1|
Sequence length 594
Comment epidermal growth factor receptor kinase substrate 8-like protein 3 isoform a [Homo sapiens]
Sequence
MSRPSSRAIYLHRKEYSQNLTSEPTLLQHRVEHLMTCKQGSQRVQGPEDALQKLFEMDAQ
GRVWSQDLILQVRDGWLQLLDIETKEELDSYRLDSIQAMNVALNTCSYNSILSITVQEPG
LPGTSTLLFQCQEVGAERLKTSLQKALEEELEQSRPRLGGLQPGQDRWRGPAMERPLPME
QARYLEPGIPPEQPHQRTLEHSLPPSPRPLPRHTSAREPSAFTLPPPRRSSSPEDPERDE
EVLNHVLRDIELFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLG
RLATWLKETSAPELVHILFKSLNFILARCPEAGLAAQVISPLLTPKAINLLQSCLSPPES
NLWMGLGPAWTTSRADWTGDEPLPYQPTFSDDWQLPEPSSQAPLGYQDPVSLRRGSHRLG
STSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALKMQVLYEFEARNPRELTVVQGEKLEV
LDHSKRWWLVKNEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQ
AENFSTATVRTLGSLTGSQLLRIRPGELQMLCPQEAPRILSRLEAVRRMLGISP
Download sequence
Identical sequences ENSP00000358820 ENSP00000358820 NP_620641.1.87134 NP_620641.1.92137 9606.ENSP00000358820 gi|21071018|ref|NP_620641.1| ENSP00000355255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]