SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21264315|ref|NP_644670.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21264315|ref|NP_644670.1|
Domain Number 1 Region: 56-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-28
Family G proteins 0.031
Further Details:      
 
Domain Number 2 Region: 445-534
Classification Level Classification E-value
Superfamily EF-hand 7.14e-22
Family Eps15 homology domain (EH domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21264315|ref|NP_644670.1|
Sequence length 541
Comment EH domain-containing protein 4 [Homo sapiens]
Sequence
MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVK
AMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKA
D
Download sequence
Identical sequences A0A024R9N6 Q9H223
ENSP00000220325 NP_644670.1.87134 NP_644670.1.92137 gi|21264315|ref|NP_644670.1| 9606.ENSP00000220325 ENSP00000220325 ENSP00000220325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]