SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21264326|ref|NP_612201.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21264326|ref|NP_612201.1|
Domain Number 1 Region: 159-364
Classification Level Classification E-value
Superfamily Rhomboid-like 2.09e-34
Family Rhomboid-like 0.0044
Further Details:      
 
Domain Number 2 Region: 33-102
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000325
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21264326|ref|NP_612201.1|
Sequence length 404
Comment rhomboid-related protein 3 [Homo sapiens]
Sequence
MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFDQFDPGNTGYISTGKFR
SLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNSFRQAILQGNRRLSS
KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYN
GVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQLLVGVP
LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK
CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN
YEQRLQDQSLWWIFVAMYTVFVLFAVFWNIFAYTLLDLKLPPPP
Download sequence
Identical sequences A0A2I3SUM7 P58872
NP_612201.1.87134 NP_612201.1.92137 XP_016787516.1.37143 gi|21264326|ref|NP_612201.1| 9606.ENSP00000269051 ENSP00000269051 ENSP00000269051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]