SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21264337|ref|NP_071926.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21264337|ref|NP_071926.4|
Domain Number 1 Region: 913-1088
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 
Domain Number 2 Region: 490-606
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.71e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 284-380
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-24
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1174-1321
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-18
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000412
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 6 Region: 605-783
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000168
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 7 Region: 391-500
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000176
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 798-906
Classification Level Classification E-value
Superfamily PH domain-like 0.00000011
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1131-1194
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000313
Family Ras-binding domain, RBD 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21264337|ref|NP_071926.4|
Sequence length 1544
Comment arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 [Homo sapiens]
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGL
LPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
Download sequence
Identical sequences Q8WWN8
NP_071926.4.87134 NP_071926.4.92137 ENSP00000239440 ENSP00000239440 ENSP00000421148 9606.ENSP00000239440 gi|21264337|ref|NP_071926.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]