SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21264359|ref|NP_624302.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21264359|ref|NP_624302.1|
Domain Number 1 Region: 409-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.96e-76
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-33
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000126
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.00097
Further Details:      
 
Domain Number 6 Region: 367-423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000595
Family Complement control module/SCR domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21264359|ref|NP_624302.1|
Sequence length 728
Comment mannan-binding lectin serine protease 1 isoform 2 precursor [Homo sapiens]
Sequence
MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW
MNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVV
LHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQS
VVEPQVER
Download sequence
Identical sequences ENSP00000296280 gi|21264359|ref|NP_624302.1| ENSP00000296280 ENSP00000296280 NP_624302.1.87134 NP_624302.1.92137 9606.ENSP00000296280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]