SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21264363|ref|NP_006601.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21264363|ref|NP_006601.2|
Domain Number 1 Region: 423-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-76
Family Eukaryotic proteases 0.00000000547
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.000000486
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-28
Family Spermadhesin, CUB domain 0.00000179
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.00000673
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0000546
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000244
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21264363|ref|NP_006601.2|
Sequence length 686
Comment mannan-binding lectin serine protease 2 isoform 1 preproprotein [Homo sapiens]
Sequence
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISDF
Download sequence
Identical sequences O00187
9606.ENSP00000383690 gi|21264363|ref|NP_006601.2| ENSP00000383690 ENSP00000383690 NP_006601.2.87134 NP_006601.2.92137 ENSP00000383690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]