SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21281673|ref|NP_644813.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21281673|ref|NP_644813.1|
Domain Number 1 Region: 51-190
Classification Level Classification E-value
Superfamily L domain-like 4.81e-34
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|21281673|ref|NP_644813.1|
Domain Number - Region: 329-439
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.0759
Family Fucose-specific lectin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21281673|ref|NP_644813.1|
Sequence length 537
Comment leucine-rich repeat LGI family member 4 precursor [Homo sapiens]
Sequence
MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLV
RTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNAL
RGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASV
GTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQP
FAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPG
LRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHA
WHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGD
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLR
LEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA
Download sequence
Identical sequences Q8N135
gi|21281673|ref|NP_644813.1| 9606.ENSP00000312273 ENSP00000312273 NP_644813.1.87134 NP_644813.1.92137 ENSP00000312273 ENSP00000312273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]