SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21281681|ref|NP_644807.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21281681|ref|NP_644807.1|
Domain Number 1 Region: 63-203
Classification Level Classification E-value
Superfamily L domain-like 4.42e-34
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 256-524
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000051
Family Soluble quinoprotein glucose dehydrogenase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21281681|ref|NP_644807.1|
Sequence length 548
Comment leucine-rich repeat LGI family member 3 precursor [Homo sapiens]
Sequence
MAGLRARGGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPR
NLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIE
NNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKW
LVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLAFPAVSAEPFL
YSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLF
GGSYIYHWDPNTTRFTRLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWH
QNGFYSHQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQV
PDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRY
LALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYR
HIVVDLSA
Download sequence
Identical sequences Q8N145
ENSP00000302297 9606.ENSP00000302297 ENSP00000302297 gi|21281681|ref|NP_644807.1| NP_644807.1.87134 NP_644807.1.92137 ENSP00000302297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]