SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361120|ref|NP_001290.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361120|ref|NP_001290.2|
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.6e-51
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21361120|ref|NP_001290.2|
Sequence length 297
Comment calponin-1 [Homo sapiens]
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
Download sequence
Identical sequences A0A2J8RYK0 G3S3B2 H2QFE4 P51911 V9HWA5
ENSP00000252456 9598.ENSPTRP00000017928 9606.ENSP00000252456 ENSPTRP00000017928 ENSGGOP00000022562 NP_001290.2.87134 NP_001290.2.92137 ENSP00000252456 ENSGGOP00000022562 ENSPTRP00000017928 ENSP00000252456 gi|21361120|ref|NP_001290.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]