SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361378|ref|NP_009032.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361378|ref|NP_009032.2|
Domain Number 1 Region: 481-820
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-86
Family Aminomethyltransferase folate-binding domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 67-288,388-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.53e-57
Family FAD-linked reductases, N-terminal domain 0.0000628
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-28
Family L-aminoacid/polyamine oxidase 0.0074
Further Details:      
 
Domain Number 4 Region: 822-916
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000000491
Family Aminomethyltransferase beta-barrel domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21361378|ref|NP_009032.2|
Sequence length 918
Comment sarcosine dehydrogenase, mitochondrial precursor [Homo sapiens]
Sequence
MASLSRALRVAAAHPRQSPTRGMGPCNLSSAAGPTAEKSVPYQRTLKEGQGTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGI
RVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAG
RNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRR
LLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAMGGAVAQHNWSHI
TTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGH
LVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHW
HADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLE
AIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQ
AHLKSPFDPNNKRVKGIY
Download sequence
Identical sequences Q9UL12
ENSP00000360938 ENSP00000403084 NP_001128179.1.87134 NP_001128179.1.92137 NP_009032.2.87134 NP_009032.2.92137 ENSP00000298628 gi|197927446|ref|NP_001128179.1| gi|21361378|ref|NP_009032.2| 9606.ENSP00000360938 ENSP00000360938 ENSP00000403084 HR6831 SARDH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]