SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361403|ref|NP_036605.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361403|ref|NP_036605.2|
Domain Number 1 Region: 63-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-33
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21361403|ref|NP_036605.2|
Sequence length 166
Comment thioredoxin, mitochondrial precursor [Homo sapiens]
Sequence
MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLT
TFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDD
HTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Download sequence
Identical sequences G3RTN8 K7C2U9 Q99757
gi|21361403|ref|NP_036605.2| ENSGGOP00000019164 ENSGGOP00000019164 ENSP00000216185 9606.ENSP00000216185 ENSP00000216185 ENSP00000385393 NP_036605.2.87134 NP_036605.2.92137 XP_003821580.1.60992 XP_004063455.1.27298 XP_006724289.1.92137 XP_008973256.1.60992 XP_016794574.1.37143 XP_016794575.1.37143 XP_016794576.1.37143 XP_018873840.1.27298 ENSP00000216185 ENSP00000385393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]