SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361460|ref|NP_055406.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361460|ref|NP_055406.2|
Domain Number 1 Region: 104-283
Classification Level Classification E-value
Superfamily EF-hand 7.89e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21361460|ref|NP_055406.2|
Sequence length 285
Comment Kv channel-interacting protein 2 isoform 1 [Homo sapiens]
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRV
FRFLGDSSLPSALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDF
VAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
REHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2I3RU08 G3QUJ2
ENSGGOP00000006396 gi|21361460|ref|NP_055406.2| 9606.ENSP00000420040 ENSGGOP00000006396 ENSP00000359063 NP_055406.2.87134 NP_055406.2.92137 XP_003825554.1.60992 XP_004050045.1.27298 XP_016774669.1.37143 ENSP00000420040 ENSP00000420040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]