SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361462|ref|NP_055416.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361462|ref|NP_055416.2|
Domain Number 1 Region: 53-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.11e-30
Family G proteins 0.023
Further Details:      
 
Domain Number 2 Region: 447-536
Classification Level Classification E-value
Superfamily EF-hand 7.88e-23
Family Eps15 homology domain (EH domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21361462|ref|NP_055416.2|
Sequence length 543
Comment EH domain-containing protein 2 [Homo sapiens]
Sequence
MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKG
SAE
Download sequence
Identical sequences A0A024R0S6 G3S6K4 Q9NZN4
NP_055416.2.87134 NP_055416.2.92137 XP_004061114.1.27298 9606.ENSP00000263277 gi|21361462|ref|NP_055416.2| ENSP00000263277 ENSGGOP00000002308 ENSGGOP00000023711 ENSP00000263277 ENSP00000263277 ENSGGOP00000002308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]