SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361559|ref|NP_003376.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361559|ref|NP_003376.2|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily EF-hand 1.96e-53
Family Calmodulin-like 0.000000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21361559|ref|NP_003376.2|
Sequence length 191
Comment visinin-like protein 1 [Homo sapiens]
Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPS
IVLLLQCDIQK
Download sequence
Identical sequences A0A087QH62 A0A091F8W0 A0A091G5X4 A0A091HL12 A0A091JD08 A0A091SIJ3 A0A091V0R9 A0A091WCY6 A0A093F0J8 A0A093HDK0 A0A093HXC2 A0A093NEE5 A0A093QT00 A0A094K9A5 A0A096N6T1 A0A099Z457 A0A0A0AJB0 A0A1S2ZK84 A0A1S3EXF5 A0A1U7QHK4 A0A1U7RF23 A0A1U7TCX4 A0A218VB74 A0A226MWM6 A0A226PY93 A0A286Y0X2 A0A2I0MTG8 A0A2J8V4D2 A0A2K5EDS5 A0A2K5INQ5 A0A2K5NXN0 A0A2K5QTF8 A0A2K5XGB7 A0A2K6C0L6 A0A2K6EHI1 A0A2K6MUZ9 A0A2K6RSY8 A0A2K6U3J8 B5G0J4 D2H0L4 F2Z5E8 F6YXV9 F7BI34 G1NMM0 G1Q5B5 G1QLM9 G1U0A2 G3HGM8 G3SAH9 G3TG43 G5AZB5 G7N9F6 G7PLN2 H2QHG8 I3MFH5 K9IGE1 L8ITW9 M3WUY2 M3YQC8 P62760 P62761 P62762 P62763 P62764 Q4R5F7 Q4W4C9 Q5RD22 R0LSH5 S7NME7 U3JGJ9 W5Q515
ENSTBEP00000009991 ENSTGUP00000013499 ENSOCUP00000022780 ENSNLEP00000001844 ENSCPOP00000000678 ENSPVAP00000014764 ENSAPLP00000009162 ENSLAFP00000013417 ENSOARP00000017805 ENSBTAP00000022814 ENSMLUP00000018898 ENSMLUP00000018898 ENSTBEP00000009991 NP_001185511.1.42559 NP_001272200.1.63531 NP_003376.2.87134 NP_003376.2.92137 NP_036168.1.92730 NP_776915.1.59421 NP_776915.1.76553 NP_990586.1.86415 XP_001135557.1.37143 XP_001503470.1.31192 XP_002710082.1.1745 XP_002758063.1.60252 XP_002915033.1.58354 XP_003204563.1.16129 XP_003275998.1.23891 XP_003411943.1.64505 XP_003472900.1.53824 XP_003787455.1.62490 XP_003827036.1.60992 XP_003935268.1.74449 XP_003984537.1.62641 XP_004005746.1.66739 XP_004028920.1.27298 XP_004274912.1.21590 XP_004324992.1.83887 XP_004387628.1.4749 XP_004407404.1.74151 XP_004418369.1.5094 XP_004609404.1.94378 XP_004627548.1.9945 XP_004663844.1.11716 XP_004686485.1.23501 XP_004696105.1.18182 XP_004745883.1.14098 XP_004839080.1.39548 XP_005015109.1.99704 XP_005044433.1.66865 XP_005044434.1.66865 XP_005079112.1.91757 XP_005143371.1.78019 XP_005240444.1.75256 XP_005322681.1.77405 XP_005366607.1.66349 XP_005400381.1.28644 XP_005420338.1.5688 XP_005432932.1.10750 XP_005489796.1.73095 XP_005506909.1.63277 XP_005521902.1.90289 XP_005576563.1.63531 XP_005687044.1.57651 XP_005884140.1.60319 XP_005891097.1.15283 XP_005973687.1.78601 XP_006018855.1.24877 XP_006051940.1.26621 XP_006096074.1.53796 XP_006140869.1.99106 XP_006191442.1.101512 XP_006197188.1.17985 XP_006268266.1.47583 XP_006268267.1.47583 XP_006733043.1.47382 XP_006767622.1.95426 XP_006835330.1.41390 XP_006880723.1.29581 XP_006910307.1.64745 XP_006996503.1.50099 XP_007080765.1.5354 XP_007127394.1.24612 XP_007127395.1.24612 XP_007183556.1.59432 XP_007464520.1.90284 XP_007520657.1.11023 XP_007641854.1.69978 XP_007945672.1.48129 XP_007969605.1.81039 XP_007969606.1.81039 XP_007969607.1.81039 XP_008055675.1.4292 XP_008160618.1.99482 XP_008493183.1.100939 XP_008640015.1.15636 XP_008698630.1.72690 XP_008698631.1.72690 XP_008822406.1.79516 XP_008929518.1.51550 XP_008929518.1.96775 XP_008950584.1.60992 XP_008979359.1.60252 XP_008979360.1.60252 XP_009093672.1.15306 XP_009288936.1.47732 XP_009332620.1.49731 XP_009440313.1.37143 XP_009462476.1.38621 XP_009554954.1.62272 XP_009640085.1.23211 XP_009678839.1.43253 XP_009678840.1.43253 XP_009678841.1.43253 XP_009678842.1.43253 XP_009678843.1.43253 XP_009678844.1.43253 XP_009678845.1.43253 XP_009678846.1.43253 XP_009883630.1.48241 XP_009907768.1.92783 XP_009935705.1.35112 XP_009988370.1.11325 XP_010000668.1.85724 XP_010123919.1.88979 XP_010161838.1.30499 XP_010189574.1.17318 XP_010212998.1.20684 XP_010344048.1.74449 XP_010353142.1.97406 XP_010353143.1.97406 XP_010353144.1.97406 XP_010353145.1.97406 XP_010391593.1.2935 XP_010564951.1.12557 XP_010605758.1.5607 XP_010838805.1.44457 XP_010838806.1.44457 XP_010838807.1.44457 XP_010838808.1.44457 XP_010945655.1.22495 XP_010987967.1.51371 XP_011354900.1.92234 XP_011575188.1.59079 XP_011575189.1.59079 XP_011575190.1.59079 XP_011575191.1.59079 XP_011575192.1.59079 XP_011575193.1.59079 XP_011575194.1.59079 XP_011575195.1.59079 XP_011747610.1.29376 XP_011747611.1.29376 XP_011747612.1.29376 XP_011806714.1.43180 XP_011806720.1.43180 XP_011826822.1.47321 XP_011826823.1.47321 XP_011899931.1.92194 XP_011899932.1.92194 XP_011899933.1.92194 XP_011976456.1.54773 XP_012294278.1.9421 XP_012353204.1.23891 XP_012508549.1.63892 XP_012508550.1.63892 XP_012781733.1.84141 XP_012869096.1.60039 XP_012908389.1.14098 XP_012925526.1.39548 XP_013028121.1.65836 XP_013208986.1.66349 XP_013810531.1.3284 XP_014162225.1.5688 XP_014637822.1.5094 XP_014703548.1.49734 XP_014750442.1.99236 XP_014812279.1.91963 XP_014812280.1.91963 XP_014812281.1.91963 XP_014812282.1.91963 XP_014812283.1.91963 XP_014812284.1.91963 XP_014812285.1.91963 XP_014812286.1.91963 XP_014812287.1.91963 XP_014812288.1.91963 XP_014812289.1.91963 XP_014933862.1.86478 XP_014967236.1.72884 XP_014967237.1.72884 XP_014967238.1.72884 XP_014967239.1.72884 XP_015140438.1.86415 XP_015140439.1.86415 XP_015140440.1.86415 XP_015140441.1.86415 XP_015140442.1.86415 XP_015335441.1.40921 XP_015477897.1.82291 XP_015477898.1.82291 XP_015715032.1.68032 XP_015715033.1.68032 XP_015715034.1.68032 XP_015845289.1.50099 XP_016009376.1.101085 XP_016080250.1.3490 XP_016153065.1.66865 XP_017381633.1.71028 XP_017505379.1.32401 XP_017505380.1.32401 XP_017600443.1.15636 XP_017600444.1.15636 XP_017600445.1.15636 XP_017600446.1.15636 XP_017600447.1.15636 XP_017600448.1.15636 XP_017600449.1.15636 XP_017680301.1.3805 XP_017680302.1.3805 XP_017680303.1.3805 XP_017726908.1.44346 XP_017726909.1.44346 XP_017944300.1.51550 XP_018776500.1.15306 XP_018776505.1.15306 XP_018876937.1.27298 XP_019306926.1.44245 XP_019337293.1.47583 XP_019376323.1.87953 XP_019376324.1.87953 XP_019392918.1.79039 XP_019392919.1.79039 XP_019608128.1.88060 XP_019826230.1.53367 XP_020028182.1.5219 XP_020028183.1.5219 XP_020144245.1.48125 XP_020765781.1.74333 XP_020823130.1.61212 XP_020943480.1.46622 XP_021057747.1.100879 XP_021247225.1.32913 XP_021247226.1.32913 XP_021247227.1.32913 XP_021247229.1.32913 XP_021247230.1.32913 XP_021247231.1.32913 XP_021381045.1.53032 XP_021381046.1.53032 XP_021381047.1.53032 XP_021497984.1.76796 XP_021553133.1.83697 ENSCPOP00000000678 ENSOCUP00000022780 gi|21361559|ref|NP_003376.2| ENSLAFP00000013417 ENSTTRP00000015074 ENSAMEP00000002775 ENSMGAP00000014837 ENSCJAP00000013555 ENSTSYP00000006833 ENSRNOP00000007609 ENSMGAP00000014837 ENSGALP00000026514 ENSSTOP00000009368 ENSPTRP00000020068 ENSRNOP00000007609 ENSPVAP00000014764 ENSSTOP00000009368 ENSP00000295156 ENSP00000384014 ENSP00000384719 ENSMUSP00000072145 ENSTSYP00000006833 ENSPPYP00000014102 ENSPPYP00000014102 ENSPPYP00000023634 ENSGGOP00000008090 ENSECAP00000011431 ENSFALP00000001903 ENSECAP00000011431 ENSMPUP00000013537 ENSMPUP00000013537 ENSP00000295156 ENSP00000384014 ENSP00000384719 ENSFCAP00000018169 ENSPANP00000008208 ENSGGOP00000025102 ENSNLEP00000001844 ENSPTRP00000020068 HGL_H00000384014 ENSMUSP00000072145 ENSGALP00000026514 ENSAMEP00000002775 ENSP00000295156 ENSMUSP00000072145 ENSTTRP00000015074 ENSCJAP00000013550 10090.ENSMUSP00000072145 10116.ENSRNOP00000007609 10141.ENSCPOP00000000678 59729.ENSTGUP00000013499 9031.ENSGALP00000026514 9598.ENSPTRP00000020068 9600.ENSPPYP00000014102 9606.ENSP00000295156 9796.ENSECAP00000011431 9823.ENSSSCP00000009184 9913.ENSBTAP00000022814 9986.ENSOCUP00000022780 ENSBTAP00000022814 ENSTGUP00000013499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]