SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361633|ref|NP_060238.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361633|ref|NP_060238.3|
Domain Number 1 Region: 24-351
Classification Level Classification E-value
Superfamily L domain-like 1.16e-60
Family Leucine rich effector protein YopM 0.076
Further Details:      
 
Domain Number 2 Region: 395-578
Classification Level Classification E-value
Superfamily L domain-like 4.68e-31
Family Ngr ectodomain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21361633|ref|NP_060238.3|
Sequence length 602
Comment leucine-rich repeat-containing protein 40 [Homo sapiens]
Sequence
MSRLKRIAGQDLRAGFKAGGRDCGTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINV
DIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSL
PSAIRELENLQKLNVSHNKLKILPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLD
LSNNHLTTVPASFSSLSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPELA
GMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAEHLKHLNSILVLDLRDNK
LKSVPDEIILLRSLERLDLSNNDISSLPYSLGNLHLKFLALEGNPLRTIRREIISKGTQE
VLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFD
AVKSNIVTSINFSKNQLCEIPKRMVELKEMVSDVDLSFNKLSFISLELCVLQKLTFLDLR
NNFLNSLPEEMESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVDPQKMKM
MENLTTLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRDRI
PT
Download sequence
Identical sequences A0A140VJN3 Q9H9A6
gi|21361633|ref|NP_060238.3| ENSP00000359990 NP_060238.3.87134 NP_060238.3.92137 9606.ENSP00000359990 ENSP00000359990 ENSP00000359990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]