SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21389431|ref|NP_653221.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21389431|ref|NP_653221.1|
Domain Number 1 Region: 66-282
Classification Level Classification E-value
Superfamily RNI-like 2.98e-48
Family 28-residue LRR 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21389431|ref|NP_653221.1|
Sequence length 335
Comment leucine-rich repeat-containing protein 39 [Homo sapiens]
Sequence
MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTRED
GRVILKIEKEEWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISE
IPPGIGLLTRLQELILSYNKIKTVPKELSNCASLEKLELAVNRDICDLPQELSNLLKLTH
LDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIERMQNLHTLWLQRNEITCLPQT
ISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPLKLKVSLPPSEGTDEEEEREL
FGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG
Download sequence
Identical sequences Q96DD0
GO.39974 gi|21389431|ref|NP_653221.1| ENSP00000344470 ENSP00000359156 NP_001243315.1.87134 NP_001243315.1.92137 NP_001243316.1.87134 NP_001243316.1.92137 NP_653221.1.87134 NP_653221.1.92137 ENSP00000344470 ENSP00000359156 9606.ENSP00000344470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]