SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|214832254|ref|NP_001135789.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|214832254|ref|NP_001135789.1|
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.68e-26
Family SCOPe 0.00000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|214832254|ref|NP_001135789.1|
Sequence length 149
Comment thioredoxin-like protein 4B [Homo sapiens]
Sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYL
VDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIY
RGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Download sequence
Identical sequences A0A2I2Y9F3 H2QBH7 Q9NX01
ENSP00000268483 ENSP00000392310 ENSP00000408130 1xbs_A ENSGGOP00000012725 cath|current|1xbsA00/1-137 9598.ENSPTRP00000014239 9606.ENSP00000268483 ENSP00000268483 NP_001135789.1.87134 NP_001135789.1.92137 NP_001135790.1.87134 NP_001135790.1.92137 NP_060323.1.87134 NP_060323.1.92137 XP_003315248.1.37143 XP_003829559.1.60992 XP_004058013.1.27298 XP_004058014.1.27298 XP_008953115.1.60992 XP_016785630.1.37143 XP_511098.2.37143 ENSGGOP00000012725 ENSPTRP00000014239 ENSPTRP00000014239 gi|214832254|ref|NP_001135789.1| gi|215272376|ref|NP_001135790.1| gi|8923475|ref|NP_060323.1| ENSP00000268483 ENSP00000392310 ENSP00000408130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]